Recombinant Human UBE2V2 protein, His-SUMO-tagged

• Cat.No.: UBE2V2-3644H
• Product Overview: Recombinant Human UBE2V2 protein(Q15819)(2-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-145aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.2 kDa
• AA Sequence: AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: UBE2V2 ubiquitin-conjugating enzyme E2 variant 2 [ Homo sapiens ]
• Official Symbol: UBE2V2
• Synonyms: UBE2V2; ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; EDPF 1; MMS2; UEV 2; MMS2 homolog; vitamin D3-inducible protein; 1 alpha,25-dihydroxyvitamin D3-inducible; enterocyte differentiation promoting factor; enterocyte differentiation-promoting factor 1; enterocyte differentiation-associated factor 1; enterocyte differentiation-associated factor EDAF-1; methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1
• Gene ID: 7336
• mRNA Refseq: NM_003350
• Protein Refseq: NP_003341
• MIM: 603001
• UniProt ID: Q15819