Recombinant Human UBE2V2, His-tagged

• Cat.No.: UBE2V2-30036TH
• Product Overview: Recombinant full length Human MMS2 with N terminal His tag; 165aa, 18.5kDa.

Specification

• Description: Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.
• Protein length: 145 amino acids
• Conjugation: HIS
• Molecular Weight: 18.500kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.24% Tris, 10% Glycerol, 0.58% Sodium chloride
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAVSTGVKVPRNFRLLEELE EGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDA RSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG QTYNN
• Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.

Gene Information

• Gene Name: UBE2V2 ubiquitin-conjugating enzyme E2 variant 2 [ Homo sapiens ]
• Official Symbol: UBE2V2
• Synonyms: UBE2V2; ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; EDPF 1; MMS2; UEV 2
• Gene ID: 7336
• mRNA Refseq: NM_003350
• Protein Refseq: NP_003341
• MIM: 603001
• Uniprot ID: Q15819
• Chromosome Location: 8q11.21
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem
• Function: acid-amino acid ligase activity; protein binding