Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBE2D3-6012H |
Product Overview : | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. |
Molecular Mass : | 16.7 kDa |
AA Sequence : | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens (human) ] |
Official Symbol | UBE2D3 |
Synonyms | UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5), ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; E2(17)KB 3; ubiquitin-protein ligase D3; ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2(17)KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UBC4/5; UBCH5C; E2(17)KB3; MGC5416; MGC43926; |
Gene ID | 7323 |
mRNA Refseq | NM_181887 |
Protein Refseq | NP_871616 |
MIM | 602963 |
UniProt ID | P61077 |
◆ Recombinant Proteins | ||
UBE2D3-5056R | Recombinant Rhesus monkey UBE2D3 Protein, His-tagged | +Inquiry |
UBE2D3-816C | Recombinant Cynomolgus Monkey UBE2D3 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2D3-205H | Recombinant Human UBE2D3, His-tagged | +Inquiry |
UBE2D3-5713H | Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBE2D3-6012H | Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2D3 Products
Required fields are marked with *
My Review for All UBE2D3 Products
Required fields are marked with *
0
Inquiry Basket