Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UBE2D3-5713H
Product Overview : UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871618) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
Molecular Mass : 16.7 kDa
AA Sequence : XWR*NGLIRNLVIWPVTLQHNVLQVQLGMICFIGKPQLWDLMTAHIKAVYSF*QFIFLQTTPSNHLRLHLQQEFIIQILTVMAAFVSIF*DHSGRLL*QFLKFFYPFVHCYVIQTQMTP*CQRLHGSIKQTEISTTEYLGNGLRSMPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens (human) ]
Official Symbol UBE2D3
Synonyms UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5), ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; E2(17)KB 3; ubiquitin-protein ligase D3; ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2(17)KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UBC4/5; UBCH5C; E2(17)KB3; MGC5416; MGC43926;
Gene ID 7323
mRNA Refseq NM_181889
Protein Refseq NP_871618
MIM 602963
UniProt ID P61077

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All UBE2D3 Products

Required fields are marked with *

My Review for All UBE2D3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon