Recombinant Human UBE2D3 protein, His-SUMO-tagged
Cat.No. : | UBE2D3-3643H |
Product Overview : | Recombinant Human UBE2D3 protein(P61077)(1-147aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.7 kDa |
AA Sequence : | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ] |
Official Symbol | UBE2D3 |
Synonyms | UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; E2(17)KB 3; ubiquitin-protein ligase D3; ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2(17)KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UBC4/5; UBCH5C; E2(17)KB3; MGC5416; MGC43926; |
Gene ID | 7323 |
mRNA Refseq | NM_003340 |
Protein Refseq | NP_003331 |
MIM | 602963 |
UniProt ID | P61077 |
◆ Recombinant Proteins | ||
UBE2D3-5056R | Recombinant Rhesus monkey UBE2D3 Protein, His-tagged | +Inquiry |
UBE2D3-2566H | Recombinant Human UBE2D3 protein, His-tagged | +Inquiry |
UBE2D3-13HFL | Active Recombinant Full Length Human/Mouse/Rat ubiquitin conjugating enzyme E2 D3 Protein, Tag Free | +Inquiry |
UBE2D3-004H | Recombinant Human UBE2D3 protein | +Inquiry |
UBE2D3-5713H | Recombinant Human UBE2D3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2D3 Products
Required fields are marked with *
My Review for All UBE2D3 Products
Required fields are marked with *
0
Inquiry Basket