Recombinant Human UBE2D2

• Cat.No.: UBE2D2-30042TH
• Product Overview: Tagged Recombinant Human UBE2D2.

Specification

• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM HEPES, 100mM Sodium chloride, pH 8
• Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: The sequence (minus the tag) is:MALKRIHKELNDLARDPPAQCSAGPVGDDMFHW QATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT RIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLC DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
• Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.
• Tag: Non

Gene Information

• Gene Name: UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ]
• Official Symbol: UBE2D2
• Synonyms: UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B
• Gene ID: 7322
• mRNA Refseq: NM_003339
• Protein Refseq: NP_003330
• MIM: 602962
• Uniprot ID: P62837
• Chromosome Location: 5q31.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem
• Function: ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding

Reviews

07/12/2022

Trusted for research integrity, supports research consistency.

10/24/2020

Outstanding accuracy, highly recommended for insights.

12/30/2017

Efficient service, accelerates our research timelines.

Q&As

How does UBE2D2 interact with other components of the ubiquitin-proteasome system?

UBE2D2 works in tandem with other ubiquitin-proteasome system components, orchestrating protein degradation.

How does UBE2D2 contribute to cellular protein degradation?

It facilitates the attachment of ubiquitin to target proteins, directing them to the proteasome for breakdown.

What role does UBE2D2 play in cell cycle regulation?

UBE2D2 plays a role in controlling the cell cycle by regulating the degradation of key cycle-related proteins.

What potential therapeutic applications arise from targeting UBE2D2 in diseases related to protein misfolding?

Targeting UBE2D2 could offer new treatments for conditions involving protein misfolding and aggregation.

What is the impact of altered UBE2D2 activity on disease development?

Altered UBE2D2 activity is linked with several diseases, including cancer and neurodegenerative disorders.

How do genetic variations in UBE2D2 affect cellular homeostasis?

Genetic mutations in UBE2D2 can disrupt protein turnover, affecting various cellular functions and stability.

What is the primary role of UBE2D2 in protein ubiquitination?

UBE2D2, a ubiquitin-conjugating enzyme, is vital for tagging proteins with ubiquitin, marking them for degradation.