Recombinant Human UBE2D2, His-tagged

• Cat.No.: UBE2D2-31647TH
• Product Overview: Recombinant full length Human UBE2D2 with an N terminal His tag; 167 amino acids with tag, Predicted MWt 18.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 167 amino acids
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
• Conjugation: HIS
• Molecular Weight: 18.900kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
• Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.

Gene Information

• Gene Name: UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ]
• Official Symbol: UBE2D2
• Synonyms: UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B
• Gene ID: 7322
• mRNA Refseq: NM_003339
• Protein Refseq: NP_003330
• MIM: 602962
• Uniprot ID: P62837
• Chromosome Location: 5q31.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem
• Function: ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding