Recombinant Human UBE2D2 protein, GST-tagged

• Cat.No.: UBE2D2-301587H
• Product Overview: Recombinant Human UBE2D2 (1-59 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Asp59
• AA Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ]
• Official Symbol: UBE2D2
• Synonyms: UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B; ubiquitin-protein ligase D2; ubiquitin carrier protein D2; ubiquitin-conjugating enzyme E2(17)KB 2; ubiquitin-conjugating enzyme E2-17 kDa 2; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); PUBC1; UBC4/5; UBCH5B; E2(17)KB2
• Gene ID: 7322
• mRNA Refseq: NM_003339
• Protein Refseq: NP_003330
• MIM: 602962
• UniProt ID: P62837