Recombinant Human UBE2D2 protein, GST-tagged
Cat.No. : | UBE2D2-301587H |
Product Overview : | Recombinant Human UBE2D2 (1-59 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asp59 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ] |
Official Symbol | UBE2D2 |
Synonyms | UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B; ubiquitin-protein ligase D2; ubiquitin carrier protein D2; ubiquitin-conjugating enzyme E2(17)KB 2; ubiquitin-conjugating enzyme E2-17 kDa 2; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); PUBC1; UBC4/5; UBCH5B; E2(17)KB2; |
Gene ID | 7322 |
mRNA Refseq | NM_003339 |
Protein Refseq | NP_003330 |
MIM | 602962 |
UniProt ID | P62837 |
◆ Recombinant Proteins | ||
ube2d2-236X | Recombinant Xenopus ube2d2, His-tagged | +Inquiry |
UBE2D2-6052R | Recombinant Rat UBE2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2D2-71H | Recombinant Full Length Human UBE2D2, His-tagged | +Inquiry |
UBE2D2-7405H | Recombinant Human UBE2D2 protein, His-tagged | +Inquiry |
UBE2D2-301587H | Recombinant Human UBE2D2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D2-587HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
UBE2D2-588HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2D2 Products
Required fields are marked with *
My Review for All UBE2D2 Products
Required fields are marked with *
0
Inquiry Basket