Recombinant Human UBE2D1 protein, GST-tagged

• Cat.No.: UBE2D1-005H
• Product Overview: Recombinant Human UBE2D1 fused with GST tag at N-terminal was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene.
• Form: Lyophilized from a 0.2 µM filtered solution of 50mM HEPES,150mM NaCl,2mM DTT,10% Glycerin pH7.5
• Molecular Mass: 42.9kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDD
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: UBE2D1 ubiquitin conjugating enzyme E2 D1 [ Homo sapiens (human) ]
• Official Symbol: UBE2D1
• Synonyms: SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1;UBE2D1
• Gene ID: 7321
• mRNA Refseq: NM_003338
• Protein Refseq: NP_003329
• MIM: 602961
• UniProt ID: P51668