Recombinant Human TXNRD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TXNRD1-5936H |
Product Overview : | TXNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_877393) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis. |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TXNRD1 thioredoxin reductase 1 [ Homo sapiens (human) ] |
Official Symbol | TXNRD1 |
Synonyms | TXNRD1; thioredoxin reductase 1; thioredoxin reductase 1, cytoplasmic; GRIM 12; Trxr1; TXNR; oxidoreductase; thioredoxin reductase TR1; thioredoxin reductase GRIM-12; KM-102-derived reductase-like factor; gene associated with retinoic and IFN-induced mortality 12 protein; gene associated with retinoic and interferon-induced mortality 12 protein; TR; TR1; TRXR1; GRIM-12; MGC9145; |
Gene ID | 7296 |
mRNA Refseq | NM_182729 |
Protein Refseq | NP_877393 |
MIM | 601112 |
UniProt ID | Q16881 |
◆ Recombinant Proteins | ||
Txnrd1-001R | Recombinant Rat Txnrd1 Protein | +Inquiry |
Txnrd1-22R | Recombinant Rat Txnrd1 Protein | +Inquiry |
Txnrd1-6754M | Recombinant Mouse Txnrd1 Protein, Myc/DDK-tagged | +Inquiry |
TXNRD1-227H | Recombinant Human TXNRD1 Protein, His-tagged | +Inquiry |
TXNRD1-5936H | Recombinant Human TXNRD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNRD1-1866HCL | Recombinant Human TXNRD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXNRD1 Products
Required fields are marked with *
My Review for All TXNRD1 Products
Required fields are marked with *
0
Inquiry Basket