Recombinant Human TRPC6 protein, hFc-tagged

• Cat.No.: TRPC6-754H
• Product Overview: Recombinant Human TRPC6 protein(Q9Y210)(543-592aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• ProteinLength: 543-592aa
• Tag: C-hFc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.7 kDa
• AASequence: ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TRPC6 transient receptor potential cation channel, subfamily C, member 6 [ Homo sapiens ]
• Official Symbol: TRPC6
• Synonyms: TRPC6; transient receptor potential cation channel, subfamily C, member 6; short transient receptor potential channel 6; TRP6; TRP-6; transient receptor protein 6; FSGS2; FLJ11098; FLJ14863
• Gene ID: 7225
• mRNA Refseq: NM_004621
• Protein Refseq: NP_004612
• MIM: 603652
• UniProt ID: Q9Y210