Recombinant Human TRAP1 protein, GST-tagged
Cat.No. : | TRAP1-3622H |
Product Overview : | Recombinant Human TRAP1 protein(446-704 aa), fused to GST tag, was expressed in E. coli. |
Availability | March 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 446-704 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRAP1 TNF receptor-associated protein 1 [ Homo sapiens ] |
Official Symbol | TRAP1 |
Synonyms | TRAP1; TNF receptor-associated protein 1; heat shock protein 75 kDa, mitochondrial; HSP75; HSP90L; HSP 75; TRAP-1; TNFR-associated protein 1; tumor necrosis factor type 1 receptor associated protein; tumor necrosis factor type 1 receptor-associated protein; |
Gene ID | 10131 |
mRNA Refseq | NM_016292 |
Protein Refseq | NP_057376 |
MIM | 606219 |
UniProt ID | Q12931 |
◆ Recombinant Proteins | ||
TRAP1-6260R | Recombinant Rat TRAP1 Protein | +Inquiry |
TRAP1-17301M | Recombinant Mouse TRAP1 Protein | +Inquiry |
TRAP1-3622H | Recombinant Human TRAP1 protein, GST-tagged | +Inquiry |
TRAP1-1324C | Recombinant Chicken TRAP1 | +Inquiry |
TRAP1-5201H | Recombinant Human TRAP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAP1-811HCL | Recombinant Human TRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRAP1 Products
Required fields are marked with *
My Review for All TRAP1 Products
Required fields are marked with *
0
Inquiry Basket