Recombinant Human TPSB2 Protein, His-tagged

• Cat.No.: TPSB2-418H
• Product Overview: Recombinant Human TPSB2 fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders.
• Form: Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0
• Molecular Mass: 29.64kD
• AA Sequence: APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: TPSB2 tryptase beta 2 (gene/pseudogene) [ Homo sapiens ]
• Official Symbol: TPSB2
• Synonyms: TPSB2; tryptase beta 2 (gene/pseudogene); tryptase beta 2; tryptase beta-2; tryptase beta II; tryptase beta III; tryptase-2; tryptase II; tryptase III; mast cell tryptase beta II; mast cell tryptase beta III; TPS2; tryptaseB; tryptaseC
• Gene ID: 64499
• mRNA Refseq: NM_024164
• Protein Refseq: NP_077078
• MIM: 191081
• UniProt ID: P20231