Recombinant Human TPSB2 protein, His-Myc-tagged

• Cat.No.: TPSB2-4610H
• Product Overview: Recombinant Human TPSB2 protein(P20231)(31-275aa), fused to C-terminal His tag and Myc tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His&Myc
• Protein Length: 31-275aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.2 kDa
• AA Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TPSB2 tryptase beta 2 (gene/pseudogene) [ Homo sapiens ]
• Official Symbol: TPSB2
• Synonyms: TPSB2; tryptase beta 2 (gene/pseudogene); tryptase beta 2; tryptase beta-2; tryptase beta II; tryptase beta III; tryptase-2; tryptase II; tryptase III; mast cell tryptase beta II; mast cell tryptase beta III; TPS2; tryptaseB; tryptaseC
• Gene ID: 64499
• mRNA Refseq: NM_024164
• Protein Refseq: NP_077078
• MIM: 191081
• UniProt ID: P20231