Recombinant Human TP53 Protein, His-tagged
| Cat.No. : | TP53-6496H |
| Product Overview : | Recombinant Human TP53 protein(Asp7-Asp393), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Asp7-Asp393 |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose. |
| Molecular Mass : | The protein has a calculated MW of 45 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.6 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD |
| Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
| Official Symbol | TP53 |
| Synonyms | TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943; |
| Gene ID | 7157 |
| mRNA Refseq | NM_000546 |
| Protein Refseq | NP_000537 |
| MIM | 191170 |
| UniProt ID | P04637 |
| ◆ Recombinant Proteins | ||
| TP53-2771H | Active Recombinant Human TP53 Protein, His-tagged | +Inquiry |
| TP53-30570TH | Recombinant Human TP53, His-tagged | +Inquiry |
| TP53-6496H | Recombinant Human TP53 Protein, His-tagged | +Inquiry |
| TP53-1044C | Recombinant Cynomolgus TP53 Protein, His-tagged | +Inquiry |
| TP53-2773H | Recombinant Human TP53 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *
