Recombinant Human TNNC1 Protein
Cat.No. : | TNNC1-007H |
Product Overview : | Recombinant human TNNC1 protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 161 |
Description : | Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. |
Form : | Solution |
Molecular Mass : | 18 kDa |
AA Sequence : | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
Purity : | > 95% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | Sodium-phosphate (pH 7). Sterile-filtered colorless solution. |
Reconstitution : | Solution for appropriate storage temperature |
Gene Name | TNNC1 troponin C1, slow skeletal and cardiac type [ Homo sapiens (human) ] |
Official Symbol | TNNC1 |
Synonyms | TNNC1; troponin C1, slow skeletal and cardiac type; TNC; TN-C; TNNC; CMD1Z; CMH13; troponin C, slow skeletal and cardiac muscles; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; troponin C type 1 (slow) |
Gene ID | 7134 |
mRNA Refseq | NM_003280 |
Protein Refseq | NP_003271 |
MIM | 191040 |
UniProt ID | P04463 |
◆ Recombinant Proteins | ||
TNNC1-154H | Recombinant Human TNNC1 Protein, DDK-tagged | +Inquiry |
TNNC1-7940H | Recombinant Human TNNC1 protein, His & GST-tagged | +Inquiry |
TNNC1-6896H | Recombinant Human Troponin C Type 1 (slow), His-tagged | +Inquiry |
TNNC1-5643H | Recombinant Human TNNC1 protein, His-tagged | +Inquiry |
TNNC1-6690C | Recombinant Chicken TNNC1 | +Inquiry |
◆ Native Proteins | ||
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNC1-885HCL | Recombinant Human TNNC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNNC1 Products
Required fields are marked with *
My Review for All TNNC1 Products
Required fields are marked with *
0
Inquiry Basket