Recombinant Human TNNC1 protein, His-tagged

• Cat.No.: TNNC1-5643H
• Product Overview: Recombinant Human TNNC1 protein(P63316)(1-161aa), fused with C-terminal His tag, was expressed in Insect cells.

Specification

• Source: Insect cells
• Species: Human
• Tag: C-His
• Protein length: 1-161aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.5 kDa
• AASequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TNNC1 troponin C type 1 (slow) [ Homo sapiens ]
• Official Symbol: TNNC1
• Synonyms: TNNC1; troponin C type 1 (slow); TNNC, troponin C, slow; troponin C, slow skeletal and cardiac muscles; troponin C1, slow; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; TNC; TN-C; TNNC; CMD1Z; CMH13
• Gene ID: 7134
• mRNA Refseq: NM_003280
• Protein Refseq: NP_003271
• MIM: 191040
• UniProt ID: P63316