Recombinant Human TNFSF8 Protein, C-His-tagged

Cat.No. : TNFSF8-189H
Product Overview : Recombinant Human TNFSF8 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Molecular Mass : ~19 kDa
AA Sequence : QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens (human) ]
Official Symbol TNFSF8
Synonyms TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144;
Gene ID 944
mRNA Refseq NM_001244
Protein Refseq NP_001235
MIM 603875
UniProt ID P32971

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TNFSF8 Products

Required fields are marked with *

My Review for All TNFSF8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon