Recombinant Human TNFSF8 Protein, C-His-tagged

• Cat.No.: TNFSF8-189H
• Product Overview: Recombinant Human TNFSF8 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
• Molecular Mass: ~19 kDa
• AA Sequence: QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens (human) ]
• Official Symbol: TNFSF8
• Synonyms: TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144
• Gene ID: 944
• mRNA Refseq: NM_001244
• Protein Refseq: NP_001235
• MIM: 603875
• UniProt ID: P32971