Recombinant Human TNFSF8, StrepII-tagged

• Cat.No.: TNFSF8-248H
• Product Overview: Purified, full-length human recombinant TNFSF8 or Tumor necrosis factor ligand superfamily member 8 protein (amino acids 1-234, 234 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.6 kDa. (Accession NP_001235.1; UniProt P329

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 1-234, 234 a.a.
• Description: This product is the extracellular domain of TNFSF8. The native form of this protein is a potent growth-promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPG LYFIICQLQFLVQCPNN
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ]
• Official Symbol: TNFSF8
• Synonyms: TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144
• Gene ID: 944
• mRNA Refseq: NM_001244
• Protein Refseq: NP_001235
• MIM: 603875
• UniProt ID: P32971
• Chromosome Location: 9q33
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding