Recombinant Human TNFRSF13B, Fc-tagged

• Cat.No.: TNFRSF13B-26H
• Product Overview: Recombinant Human TNFRSF13B, fused to Fc-tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Description: The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Form: PBS, pH7.4
• Molecular Mass: 35.3 kDa
• AA Sequence: AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: ＜0.1EU/ug by LAL.
• Purity: >95%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.12mg/ml

Gene Information

• Gene Name: TNFRSF13B TNF receptor superfamily member 13B [ Homo sapiens (human) ]
• Official Symbol: TNFRSF13B
• Synonyms: CVID; RYZN; TACI; CD267; CVID2; IGAD2; TNFRSF14B
• Gene ID: 23495
• mRNA Refseq: NM_012452
• Protein Refseq: NP_036584
• MIM: 604907
• UniProt ID: O14836