Recombinant Human TMSB4X protein

• Cat.No.: TMSB4X-653H
• Product Overview: Recombinant Human TMSB4X protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• ProteinLength: 43
• Description: Thymosin Beta 4 is a naturally occurring peptide encoded by the TMSB4X gene located on Chr. X in humans. It is found in high concentrations in blood platelets, wound fluid and other tissues in the body. Tβ-4 is a major actin regulating peptide and the primary function is to stimulate the productions of T cells, which plays important part of the immune system. The thymosin beta-4 peptide, if used after a heart attack, might reactivate cardiac progenitor cells to repair damaged heart tissue.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml.
• Molecular Mass: Approximately 4.9 kDa, a single non-glycosylated polypeptide chain containing 43 amino acids.
• AA Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Endotoxin: Less than 1 EU/µg of rHuTβ4 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TMSB4X
• Official Symbol: TMSB4X
• Synonyms: TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X; t beta-4; prothymosin beta-4; thymosin, beta 4, X chromosome; FX; PTMB4; TMSB4
• Gene ID: 7114
• mRNA Refseq: NM_021109
• Protein Refseq: NP_066932
• MIM: 300159
• UniProt ID: P62328