Recombinant Human TMSB4X protein

Cat.No. : TMSB4X-653H
Product Overview : Recombinant Human TMSB4X protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 43
Description : Thymosin Beta 4 is a naturally occurring peptide encoded by the TMSB4X gene located on Chr. X in humans. It is found in high concentrations in blood platelets, wound fluid and other tissues in the body. Tβ-4 is a major actin regulating peptide and the primary function is to stimulate the productions of T cells, which plays important part of the immune system. The thymosin beta-4 peptide, if used after a heart attack, might reactivate cardiac progenitor cells to repair damaged heart tissue.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml.
Molecular Mass : Approximately 4.9 kDa, a single non-glycosylated polypeptide chain containing 43 amino acids.
AA Sequence : SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Endotoxin : Less than 1 EU/µg of rHuTβ4 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TMSB4X
Official Symbol TMSB4X
Synonyms TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X; t beta-4; prothymosin beta-4; thymosin, beta 4, X chromosome; FX; PTMB4; TMSB4;
Gene ID 7114
mRNA Refseq NM_021109
Protein Refseq NP_066932
MIM 300159
UniProt ID P62328

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMSB4X Products

Required fields are marked with *

My Review for All TMSB4X Products

Required fields are marked with *

0

Inquiry Basket

cartIcon