Recombinant Human TMSB4X

• Cat.No.: TMSB4X-30407TH
• Product Overview: Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa;.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 44 amino acids
• Description: This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y.
• Molecular Weight: 30.840kDa inclusive of tags
• Tissue specificity: Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Sequence Similarities: Belongs to the thymosin beta family.

Gene Information

• Gene Name: TMSB4X thymosin beta 4, X-linked [ Homo sapiens ]
• Official Symbol: TMSB4X
• Synonyms: TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X
• Gene ID: 7114
• mRNA Refseq: NM_021109
• Protein Refseq: NP_066932
• MIM: 300159
• Uniprot ID: P62328
• Chromosome Location: Xq21.3-q22
• Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem
• Function: actin binding; protein binding