Recombinant Human TMSB4X Protein (43 aa)

• Cat.No.: TMSB4X-051T
• Product Overview: Recombinant Human TMSB4X Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 43
• Description: Thymosin Beta 4 is a naturally occurring peptide. It is found in high concentrations in blood platelets, wound fluid and other tissues in the body. Tβ4 is not a growth factor; rather, it is a major actin regulating peptide. The thymosin beta-4 peptide, if used after a heart attack, might reactivate cardiac progenitor cells to repair damaged heart tissue.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Data is not available.
• Molecular Mass: Approximately 4.9 kDa, a single non-glycosylated polypeptide chain containing 43 amino acids.
• AA Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Endotoxin: Less than 1 EU/mg of rHuTβ4 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TMSB4X thymosin beta 4 X-linked [ Homo sapiens (human) ]
• Official Symbol: TMSB4X
• Synonyms: TMSB4X; thymosin beta 4 X-linked; FX; TB4X; PTMB4; TMSB4
• Gene ID: 7114
• mRNA Refseq: NM_021109
• Protein Refseq: NP_066932
• MIM: 300159
• UniProt ID: P62328