Recombinant Human TMPRSS2 Protein(106-492aa), MBP&His-Avi-tagged, Biotinylated

• Cat.No.: TMPRSS2-05943H
• Product Overview: Biotinylated Recombinant Human TMPRSS2 Protein(106-492aa)(O15393), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Avi&His&MBP
• Protein Length: 106-492aa
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 90.6 kDa
• AA Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ]
• Official Symbol: TMPRSS2
• Synonyms: TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; epitheliasin; serine protease 10; PP9284; FLJ41954
• Gene ID: 7113
• mRNA Refseq: NM_001135099
• Protein Refseq: NP_001128571
• MIM: 602060
• UniProt ID: O15393