Recombinant Human TMPRSS2 protein, GST-tagged
Cat.No. : | TMPRSS2-70H |
Product Overview : | Human TMPRSS2 full-length ORF ( AAH51839.1, 1 a.a. - 492 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Molecular Mass : | 79.86 kDa |
AA Sequence : | MALNSGSPPAIEPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASDPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMPRSS2 transmembrane serine protease 2 [ Homo sapiens (human) ] |
Official Symbol | TMPRSS2 |
Synonyms | TMPRSS2; transmembrane serine protease 2; PP9284; PRSS10; transmembrane protease serine 2; epitheliasin; serine protease 10; transmembrane protease, serine 2; NP_001128571.1; EC 3.4.21.-; EC 3.4.21.- |
Gene ID | 7113 |
mRNA Refseq | NM_005656 |
Protein Refseq | NP_005647 |
MIM | 602060 |
UniProt ID | O15393 |
◆ Recombinant Proteins | ||
Tmprss2-429R | Recombinant Rat Tmprss2 Protein, His-tagged | +Inquiry |
TMPRSS2-01H | Recombinant Human TMPRSS2 protein | +Inquiry |
Tmprss2-8078M | Recombinant Mouse Tmprss2 protein, His & T7-tagged | +Inquiry |
TMPRSS2-4594H | Recombinant Human TMPRSS2 protein, GST-tagged | +Inquiry |
TMPRSS2-4595H | Active Recombinant Human TMPRSS2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *
0
Inquiry Basket