Active Recombinant Human TMPRSS2 Protein, His-tagged

• Cat.No.: TMPRSS2-02H
• Product Overview: Rcombinant Human TMPRSS2 [106-492 aa(R255Q)] Protein with a N-terminal 10xHis-tag was expressed in mammalian cell.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: His
• ProteinLength: 106-492
• Description: This gene encodes a secreted ligand of the glial cell line-derived neurotrophic factor (GDNF) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein signals through the RET receptor and GFR alpha 3 coreceptor, and supports the survival of a number of peripheral neuron populations and at least one population of dopaminergic CNS neurons. Mice lacking a functional copy of this gene exhibit ptosis and impaired development of the sympathetic nervous system.
• Form: Lyophilized powder
• Bio-activity: Recombinant Human TMPRSS2 His tag protein enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 19.16μM.
• Molecular Mass: 47.8 kDa
• AA Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
• Endotoxin: <1.0 EU/μg of the protein by the LAL method.
• Purity: ≥85% by SDS-PAGE quantitative densitometry by Coomassie Blue Staining
• Stability: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
  Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade.
• Storage: Short term: 2 to 8 centigrade, one week after reconstitution
  Long term: -20 to -80 centigrade, twelve months from the date of receipt
• Storage Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
  The volume before lyophilization is 20μL/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: TMPRSS2 transmembrane serine protease 2 [ Homo sapiens (human) ]
• Official Symbol: TMPRSS2
• Synonyms: TMPRSS2; transmembrane serine protease 2; PRSS10; transmembrane protease serine 2; epitheliasin; serine protease 10; transmembrane protease, serine 2; EC 3.4.21.-
• Gene ID: 7113
• mRNA Refseq: NM_005656
• Protein Refseq: NP_005647
• MIM: 602060
• UniProt ID: O15393