Recombinant Human TMOD1 protein, T7-tagged

• Cat.No.: TMOD1-175H
• Product Overview: Recombinant human TMOD (359aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: T7
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTG PFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAIL GMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEM KIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro COP9 signalosome (CSN) regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
• Protein length: 359 a.a.

Gene Information

• Gene Name: TMOD1 tropomodulin 1 [ Homo sapiens ]
• Official Symbol: TMOD1
• Synonyms: TMOD1; tropomodulin 1; D9S57E, TMOD; tropomodulin-1; ETMOD; E-Tmod; e-tropomodulin; erythrocyte tropomodulin; TMOD; D9S57E
• Gene ID: 7111
• mRNA Refseq: NM_001166116
• Protein Refseq: NP_001159588
• MIM: 190930
• UniProt ID: P28289
• Chromosome Location: 9q22
• Pathway: Muscle contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem
• Function: actin binding; tropomyosin binding