Recombinant Human TK1, His-tagged
Cat.No. : | TK1-31518TH |
Product Overview : | Recombinant full length Human Thymidine Kinase 1 protein with an N terminal His tag. Predicted MWt: 27 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRV RRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPA CLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMEC FREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKAS GQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
Sequence Similarities : | Belongs to the thymidine kinase family. |
Full Length : | Full L. |
Gene Name | TK1 thymidine kinase 1, soluble [ Homo sapiens ] |
Official Symbol | TK1 |
Synonyms | TK1; thymidine kinase 1, soluble; thymidine kinase, cytosolic; |
Gene ID | 7083 |
mRNA Refseq | NM_003258 |
Protein Refseq | NP_003249 |
MIM | 188300 |
Uniprot ID | P04183 |
Chromosome Location | 17q23.2-q25.3 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; kinase activity; metal ion binding; nucleoside kinase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
UHRF1-6095R | Recombinant Rat UHRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pvr-624M | Active Recombinant Mouse PVR Protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
MTA1-2458H | Recombinant Human MTA1 protein, GST-tagged | +Inquiry |
BOP1-308H | Recombinant Human BOP1 Protein, GST-tagged | +Inquiry |
RNF25-2917C | Recombinant Chicken RNF25 | +Inquiry |
◆ Native Proteins | ||
EGF-23H | Active Native Human EGF protein | +Inquiry |
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTG1-1145HCL | Recombinant Human MTG1 cell lysate | +Inquiry |
Thyroid-529C | Cynomolgus monkey Thyroid Lysate | +Inquiry |
NCAPD2-372HCL | Recombinant Human NCAPD2 cell lysate | +Inquiry |
SMR3B-001HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
NLRP1-3804HCL | Recombinant Human NLRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TK1 Products
Required fields are marked with *
My Review for All TK1 Products
Required fields are marked with *
0
Inquiry Basket