Recombinant Human TIMP1 protein, His-tagged

• Cat.No.: TIMP1-3036H
• Product Overview: Recombinant Human TIMP1 protein(58-207 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 58-207 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: YQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TIMP1 TIMP metallopeptidase inhibitor 1 [ Homo sapiens ]
• Official Symbol: TIMP1
• Synonyms: TIMP1; TIMP metallopeptidase inhibitor 1; CLGI, TIMP, tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor); metalloproteinase inhibitor 1; EPO; TIMP-1; collagenase inhibitor; erythroid potentiating activity; erythroid-potentiating activity; fibroblast collagenase inhibitor; tissue inhibitor of metalloproteinases 1; EPA; HCI; CLGI; TIMP; FLJ90373
• Gene ID: 7076
• mRNA Refseq: NM_003254
• Protein Refseq: NP_003245
• MIM: 305370
• UniProt ID: P01033