Recombinant Human TFF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TFF2-5458H
• Product Overview: TFF2 MS Standard C13 and N15-labeled recombinant protein (NP_005414) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.3 kDa
• AA Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TFF2 trefoil factor 2 [ Homo sapiens (human) ]
• Official Symbol: TFF2
• Synonyms: TFF2; trefoil factor 2; SML1, spasmolytic protein 1; spasmolysin; spasmolytic protein 1; spasmolytic polypeptide; SP; SML1
• Gene ID: 7032
• mRNA Refseq: NM_005423
• Protein Refseq: NP_005414
• MIM: 182590
• UniProt ID: Q03403