Recombinant Human TFAP2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TFAP2A-1480H
Product Overview : TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 47.2 kDa
AA Sequence : MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TFAP2A transcription factor AP-2 alpha [ Homo sapiens (human) ]
Official Symbol TFAP2A
Synonyms TFAP2A; transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha); AP2TF, TFAP2, transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); transcription factor AP-2-alpha; AP 2; AP2-alpha; activator protein 2; AP-2 transcription factor; activating enhancer-binding protein 2-alpha; AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; FLJ51761;
Gene ID 7020
mRNA Refseq NM_001032280
Protein Refseq NP_001027451
MIM 107580
UniProt ID P05549

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TFAP2A Products

Required fields are marked with *

My Review for All TFAP2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon