Recombinant Human TFAP2A protein, His-tagged

• Cat.No.: TFAP2A-3351H
• Product Overview: Recombinant Human TFAP2A protein(79-431 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 79-431 aa
• AA Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TFAP2A transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) [ Homo sapiens ]
• Official Symbol: TFAP2A
• Synonyms: TFAP2A; transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha); AP2TF, TFAP2, transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); transcription factor AP-2-alpha; AP 2; AP2-alpha; activator protein 2; AP-2 transcription factor; activating enhancer-binding protein 2-alpha; AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; FLJ51761
• Gene ID: 7020
• mRNA Refseq: NM_001032280
• Protein Refseq: NP_001027451
• MIM: 107580
• UniProt ID: P05549