Recombinant Mouse TFAP2A Protein (1-437 aa), His-Myc-tagged

• Cat.No.: TFAP2A-2591M
• Product Overview: Recombinant Mouse TFAP2A Protein (1-437 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Description: Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.
• Source: E. coli
• Species: Mouse
• Tag: His&Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 55.0 kDa
• Protein length: 1-437 aa
• AA Sequence: MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSAKSSDKEEKHRK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Tfap2a transcription factor AP-2, alpha [ Mus musculus ]
• Official Symbol: TFAP2A
• Synonyms: TFAP2A; Ap-2 (a); AP2-alpha; AP-2 alpha; activator protein 2; Ap2; AP-2; Ap2tf; Tcfap2a; AP2alpha
• Gene ID: 21418
• mRNA Refseq: NM_001122948
• Protein Refseq: NP_001116420
• UniProt ID: P34056