Recombinant Human TFAM, His-tagged

• Cat.No.: TFAM-30255TH
• Product Overview: Recombinant full length Human mtTFA with N terminal His tag; 225 amino acids with tag, MWt 26.6 kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 204 amino acids
• Description: This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
• Conjugation: HIS
• Molecular Weight: 26.600kDa inclusive of tags
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
• Sequence Similarities: Contains 2 HMG box DNA-binding domains.

Gene Information

• Gene Name: TFAM transcription factor A, mitochondrial [ Homo sapiens ]
• Official Symbol: TFAM
• Synonyms: TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2
• Gene ID: 7019
• mRNA Refseq: NM_003201
• Protein Refseq: NP_003192
• MIM: 600438
• Uniprot ID: Q00059
• Chromosome Location: 10q21
• Pathway: Energy Metabolism, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem; Mitochondrial transcription initiation, organism-specific biosystem
• Function: DNA binding; chromatin binding; mitochondrial light strand promoter sense binding; protein binding; sequence-specific DNA binding transcription factor activity