Recombinant Human TFAM protein, GST-tagged
Cat.No. : | TFAM-301323H |
Product Overview : | Recombinant Human TFAM (50-118 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro50-Lys118 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TFAM transcription factor A, mitochondrial [ Homo sapiens ] |
Official Symbol | TFAM |
Synonyms | TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; TCF-6; transcription factor 6; mitochondrial transcription factor 1; mitochondrial transcription factor A; Transcription factor 6-like 2 (mitochondrial transcription factor); TCF6; MtTF1; mtTFA; TCF6L1; TCF6L2; TCF6L3; |
Gene ID | 7019 |
mRNA Refseq | NM_003201 |
Protein Refseq | NP_003192 |
MIM | 600438 |
UniProt ID | Q00059 |
◆ Recombinant Proteins | ||
TFAM-9148M | Recombinant Mouse TFAM Protein, His (Fc)-Avi-tagged | +Inquiry |
TFAM-6414H | Recombinant Human TFAM Protein (Ser43-Cys246), N-GST tagged | +Inquiry |
TFAM-6024R | Recombinant Rat TFAM Protein | +Inquiry |
TFAM-16675M | Recombinant Mouse TFAM Protein | +Inquiry |
TFAM-301323H | Recombinant Human TFAM protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFAM-1765HCL | Recombinant Human TFAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFAM Products
Required fields are marked with *
My Review for All TFAM Products
Required fields are marked with *
0
Inquiry Basket