Recombinant Human TAL2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TAL2-5159H
• Product Overview: TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.3 kDa
• AA Sequence: MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TAL2 T-cell acute lymphocytic leukemia 2 [ Homo sapiens (human) ]
• Official Symbol: TAL2
• Synonyms: TAL2; T-cell acute lymphocytic leukemia 2; T-cell acute lymphocytic leukemia protein 2; bHLHa19; TAL-2; class A basic helix-loop-helix protein 19
• Gene ID: 6887
• mRNA Refseq: NM_005421
• Protein Refseq: NP_005412
• MIM: 186855
• UniProt ID: Q16559