Recombinant Human TAC3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TAC3-4009H
• Product Overview: TAC3 MS Standard C13 and N15-labeled recombinant protein (NP_037383) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded preproprotein is proteolytically processed to generate the mature peptide, which is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. This peptide is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.4 kDa
• AA Sequence: MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TAC3 tachykinin 3 [ Homo sapiens (human) ]
• Official Symbol: TAC3
• Synonyms: TAC3; tachykinin 3; neurokinin beta, neuromedin K, NKNB; tachykinin-3; NKB; ZNEUROK1; neuromedin K; gamma tachykinin 3; preprotachykinin B; NKNB; PRO1155
• Gene ID: 6866
• mRNA Refseq: NM_013251
• Protein Refseq: NP_037383
• MIM: 162330
• UniProt ID: Q9UHF0