Recombinant Human TAC3, His-tagged

• Cat.No.: TAC3-29652TH
• Product Overview: Recombinant full length Human Neurokinin B with an N terminal His tag; 125 amino acids with a predicted MWt 13.8 kDa including tag.

Specification

• Description: This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded protein is primarily expressed in the central and peripheral nervous system and functions as a neurotransmitter. This protein is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternate splicing results in multiple transcript variants.
• Protein length: 105 amino acids
• Conjugation: HIS
• Molecular Weight: 13.800kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHQSFGAVCKEPQEEVVPGGGR SKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTS PEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKY PPRAE
• Sequence Similarities: Belongs to the tachykinin family.

Gene Information

• Gene Name: TAC3 tachykinin 3 [ Homo sapiens ]
• Official Symbol: TAC3
• Synonyms: TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1
• Gene ID: 6866
• mRNA Refseq: NM_001178054
• Protein Refseq: NP_001171525
• MIM: 162330
• Uniprot ID: Q9UHF0
• Chromosome Location: 12q13-q21
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem
• Function: receptor binding