Recombinant Human SUGT1 protein, T7-tagged

• Cat.No.: SUGT1-119H
• Product Overview: Recombinant human SUGT1 fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQENGRGEFAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNY CVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTH QSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIE IKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYS DGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: SUGT1 SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUGT1
• Synonyms: SUGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); suppressor of G2 allele of SKP1 homolog; SGT1; SGT1B protein; putative 40-6-3 protein; suppressor of G2 allele of SKP1, S. cerevisiae, homolog of
• Gene ID: 10910
• mRNA Refseq: NM_001130912
• Protein Refseq: NP_001124384
• MIM: 604098
• UniProt ID: Q9Y2Z0
• Chromosome Location: 13q12.2-q13.3
• Pathway: Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways, organism-specific biosystem; The NLRP3 inflammasome, organism-specific biosystem
• Function: binding