Recombinant Human SUGT1, His-tagged

• Cat.No.: SUGT1-30460TH
• Product Overview: Recombinant fragment corresponding to amino acids 115-365 of Human SUGT1 with N terminal His tag; 272 amino acids with tag, MWt 30.7 kDa inclusive of tag.

Specification

• Description: This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 251 amino acids
• Conjugation: HIS
• Molecular Weight: 30.700kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
• Sequence Similarities: Belongs to the SUGT1 family.Contains 1 CS domain.Contains 1 SGS domain.Contains 3 TPR repeats.

Gene Information

• Gene Name: SUGT1 SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUGT1
• Synonyms: SUGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); suppressor of G2 allele of SKP1 homolog; SGT1
• Gene ID: 10910
• mRNA Refseq: NM_006704
• Protein Refseq: NP_006695
• MIM: 604098
• Uniprot ID: Q9Y2Z0
• Chromosome Location: 13q12.2-q13.3
• Pathway: Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem
• Function: binding