Recombinant Human SPC24 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPC24-5620H
• Product Overview: SPC24 MS Standard C13 and N15-labeled recombinant protein (NP_872319) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SPC24 (SPC24 Component Of NDC80 Kinetochore Complex) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Mitotic Prometaphase.
• Molecular Mass: 22.4 kDa
• AA Sequence: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPC24 SPC24 component of NDC80 kinetochore complex [ Homo sapiens (human) ]
• Official Symbol: SPC24
• Synonyms: SPC24; SPC24 component of NDC80 kinetochore complex; SPBC24; kinetochore protein Spc24; SPC24, NDC80 kinetochore complex component, homolog; hSpc24; spindle pole body component 24 homolog
• Gene ID: 147841
• mRNA Refseq: NM_182513
• Protein Refseq: NP_872319
• MIM: 609394
• UniProt ID: Q8NBT2