Recombinant Human SP100

Cat.No. : SP100-30989TH
Product Overview : Recombinant fragment of Human SP100 with N terminal proprietary tag, 36.41kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Widely expressed. Sp100-B is expressed only in spleen, tonsil, thymus, mature B-cell line and some T-cell line, but not in brain, liver, muscle or non-lymphoid cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Sequence Similarities : Contains 2 HMG box DNA-binding domains.Contains 1 HSR domain.Contains 1 SAND domain.
Gene Name SP100 SP100 nuclear antigen [ Homo sapiens ]
Official Symbol SP100
Synonyms SP100; SP100 nuclear antigen; nuclear antigen Sp100; nuclear autoantigen Sp-100;
Gene ID 6672
mRNA Refseq NM_001080391
Protein Refseq NP_001073860
MIM 604585
Uniprot ID P23497
Chromosome Location 2q37.1
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function chromo shadow domain binding; identical protein binding; kinase binding; protein binding; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SP100 Products

Required fields are marked with *

My Review for All SP100 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon