Recombinant Human SOX9 Protein, GST-tagged

Cat.No. : SOX9-3045H
Product Overview : Human SOX9 partial ORF ( NP_000337, 400 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
Form : Liquid
Molecular Mass : 37.84 kDa
AA Sequence : EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SOX9 SRY (sex determining region Y)-box 9 [ Homo sapiens ]
Official Symbol SOX9
Synonyms SOX9; SRY (sex determining region Y)-box 9; campomelic dysplasia, autosomal sex reversal , CMD1, CMPD1; transcription factor SOX-9; SRA1; SRY-related HMG-box, gene 9; SRY (sex-determining region Y)-box 9 protein; CMD1; CMPD1;
Gene ID 6662
mRNA Refseq NM_000346
Protein Refseq NP_000337
MIM 608160
UniProt ID P48436

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOX9 Products

Required fields are marked with *

My Review for All SOX9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon