Recombinant Human SOX6 protein(21-260 aa), C-His-tagged

• Cat.No.: SOX6-2740H
• Product Overview: Recombinant Human SOX6 protein(P35712)(21-260 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-260 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQQQIQV

Gene Information

• Gene Name: SOX6 SRY (sex determining region Y)-box 6 [ Homo sapiens ]
• Official Symbol: SOX6
• Synonyms: SOX6; SRY (sex determining region Y)-box 6; transcription factor SOX-6; SRY-box containing gene 6; SOXD; HSSOX6
• Gene ID: 55553
• mRNA Refseq: NM_001145811
• Protein Refseq: NP_001139283
• MIM: 607257
• UniProt ID: P35712