Recombinant Human SOX14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SOX14-6436H
• Product Overview: SOX14 MS Standard C13 and N15-labeled recombinant protein (NP_004180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome.
• Molecular Mass: 26.5 kDa
• AA Sequence: MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAMSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SOX14 SRY-box transcription factor 14 [ Homo sapiens (human) ]
• Official Symbol: SOX14
• Synonyms: SOX14; SRY-box transcription factor 14; transcription factor SOX-14; HMG box transcription factor SOX 14; SOX28; SRY box 14; SRY-box 14; HMG box transcription factor SOX-14; MGC119898; MGC119899
• Gene ID: 8403
• mRNA Refseq: NM_004189
• Protein Refseq: NP_004180
• MIM: 604747
• UniProt ID: O95416