Recombinant Human SLX1B Protein, GST-tagged

Description :	This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene. [provided by RefSeq, Nov 2010]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	57.2 kDa
AA Sequence :	MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	SLX1B SLX1 homolog B, structure-specific endonuclease subunit [ Homo sapiens (human) ]
Official Symbol	SLX1B
Synonyms	SLX1B; SLX1 homolog B, structure-specific endonuclease subunit; GIYD2; structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1; SLX1 structure-specific endonuclease subunit homolog B
Gene ID	79008
mRNA Refseq	NM_024044
Protein Refseq	NP_076949
MIM	615823
UniProt ID	Q9BQ83