Recombinant Full Length Human SLX1B Protein, GST-tagged

Cat.No. : SLX1B-5289HF
Product Overview : Human GIYD2 full-length ORF ( NP_076949.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 275 amino acids
Description : This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene. [provided by RefSeq, Nov 2010]
Molecular Mass : 57.2 kDa
AA Sequence : MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SLX1B SLX1 homolog B, structure-specific endonuclease subunit [ Homo sapiens (human) ]
Official Symbol SLX1B
Synonyms SLX1B; SLX1 homolog B, structure-specific endonuclease subunit; GIYD2; structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1; SLX1 structure-specific endonuclease subunit homolog B
Gene ID 79008
mRNA Refseq NM_024044
Protein Refseq NP_076949
MIM 615823
UniProt ID Q9BQ83

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLX1B Products

Required fields are marked with *

My Review for All SLX1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon