Recombinant Human SLC52A1 Protein
Cat.No. : | SLC52A1-5211H |
Product Overview : | Human GPR172B full-length ORF (NP_060456.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | GPCR41 (MIM 607882) and GPCR42 act as receptors for porcine endogenous retrovirus subgroup A (PERV-A).[supplied by OMIM |
Source : | Wheat Germ |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Tag : | Non |
Gene Name | SLC52A1 solute carrier family 52 member 1 [ Homo sapiens (human) ] |
Official Symbol | SLC52A1 |
Synonyms | SLC52A1; solute carrier family 52 member 1; PAR2; RFT1; RBFVD; RFVT1; hRFT1; GPCR42; GPR172B; solute carrier family 52, riboflavin transporter, member 1; G protein-coupled receptor 172B; G-protein coupled receptor GPCR42; PERV-A receptor 2; porcine endogenous retrovirus A receptor 2; solute carrier family 52 (riboflavin transporter), member 1 |
Gene ID | 55065 |
mRNA Refseq | NM_001104577 |
Protein Refseq | NP_001098047 |
MIM | 607883 |
UniProt ID | Q9NWF4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SLC52A1 Products
Required fields are marked with *
My Review for All SLC52A1 Products
Required fields are marked with *
0
Inquiry Basket