Recombinant Full Length Human SLC52A1 Protein, GST-tagged

• Cat.No.: SLC52A1-5487HF
• Product Overview: Human GPR172B full-length ORF ( NP_060456.2, 1 a.a. - 448 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPCR41 (MIM 607882) and GPCR42 act as receptors for porcine endogenous retrovirus subgroup A (PERV-A).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 72.8 kDa
• Protein length: 448 amino acids
• AA Sequence: MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLC52A1 solute carrier family 52 member 1 [ Homo sapiens (human) ]
• Official Symbol: SLC52A1
• Synonyms: SLC52A1; solute carrier family 52 member 1; PAR2; RFT1; RBFVD; RFVT1; hRFT1; GPCR42; GPR172B; solute carrier family 52, riboflavin transporter, member 1; G protein-coupled receptor 172B; G-protein coupled receptor GPCR42; PERV-A receptor 2; porcine endogenous retrovirus A receptor 2; solute carrier family 52 (riboflavin transporter), member 1
• Gene ID: 55065
• mRNA Refseq: NM_001104577
• Protein Refseq: NP_001098047
• MIM: 607883
• UniProt ID: Q9NWF4