Recombinant Full Length Human SLC52A1 Protein

• Cat.No.: SLC52A1-5485HF
• Product Overview: Human GPR172B full-length ORF (NP_060456.2) recombinant protein without tag.

Specification

• Description: GPCR41 (MIM 607882) and GPCR42 act as receptors for porcine endogenous retrovirus subgroup A (PERV-A).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 46.4 kDa
• Protein length: 1,010 amino acids
• AA Sequence: MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: SLC52A1 solute carrier family 52 member 1 [ Homo sapiens (human) ]
• Official Symbol: SLC52A1
• Synonyms: SLC52A1; solute carrier family 52 member 1; PAR2; RFT1; RBFVD; RFVT1; hRFT1; GPCR42; GPR172B; solute carrier family 52, riboflavin transporter, member 1; G protein-coupled receptor 172B; G-protein coupled receptor GPCR42; PERV-A receptor 2; porcine endogenous retrovirus A receptor 2; solute carrier family 52 (riboflavin transporter), member 1
• Gene ID: 55065
• mRNA Refseq: NM_001104577
• Protein Refseq: NP_001098047
• MIM: 607883
• UniProt ID: Q9NWF4